PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000319124
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 416aa    MW: 45729.2 Da    PI: 5.7115
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000319124genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.4e-1669114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W++eEd  l ++v  +G ++W++Iar +  gR++k+c++rw + 
    MDP0000319124  69 KGPWSPEEDAVLSRLVSNFGARNWSLIARGID-GRSGKSCRLRWCNQ 114
                      79******************************.***********985 PP

2Myb_DNA-binding51.42.5e-16121165147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T  Ed  +v a++ +G++ W++Iar ++ gRt++ +k++w++ 
    MDP0000319124 121 RKPFTDAEDRMIVAAHAVHGNK-WAAIARLLP-GRTDNAIKNHWNST 165
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.87264115IPR017930Myb domain
SuperFamilySSF466896.74E-2967162IPR009057Homeodomain-like
SMARTSM007178.5E-1368117IPR001005SANT/Myb domain
PfamPF002496.4E-1569114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2470122IPR009057Homeodomain-like
CDDcd001672.10E-1271113No hitNo description
PROSITE profilePS5129425.641116170IPR017930Myb domain
SMARTSM007178.2E-16120168IPR001005SANT/Myb domain
PfamPF002491.4E-13121165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-23123169IPR009057Homeodomain-like
CDDcd001671.29E-11123166No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MGAVFYRVNG NNSSTSSLLL RLRIEMEMEV AADPAAVEID AGDCGDCGEE AAAGGGAGSR  60
RKSGRDNVKG PWSPEEDAVL SRLVSNFGAR NWSLIARGID GRSGKSCRLR WCNQLDPAVK  120
RKPFTDAEDR MIVAAHAVHG NKWAAIARLL PGRTDNAIKN HWNSTLKRRC MDPXKIKLES  180
GNMVEDVSLD KTKGSSEETF SYGDVNSSKS MEGREVSSFQ HMDDQDEYNG SSEVQFSHEA  240
TEQPNLFRPV ARISAFSVYN QSNSQEXESS FPRPIPAXGP LVRESKLDVG XSKFLKGVYG  300
ELSVPDQCAH GCCCAQNGMN FQNSLLGPEF VEFSEPPXFP SFELAAIATD ISNLAWLKSG  360
LENNXVRGMG DAAGRITTHE SQGQMXRFED SRTNHLFPVE ERNDRRMGMK TNVLST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-40661694107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.128660.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744590.0DQ074459.1 Malus x domestica MYB2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008370028.10.0PREDICTED: transcription factor MYB59-like
TrEMBLQ2LMF30.0Q2LMF3_MALDO; MYB2
STRINGVIT_08s0007g01540.t011e-174(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.13e-87myb domain protein 1